| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343569.1 | internal | 227 | 683-3(-) |
Amino Acid sequence : | |||
| AYETCTDAPACQSTRHDAFGRLPHDVGPTPVHLRRVLPGESTTAVSSPATVSVDDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHG VDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDLFRSFGEVAVNTLSNIRALLLNILQSLAIISIKSY | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,564.533 | ||
| Theoretical pI: | 7.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 26.221 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.229 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343569.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| VRLDADNCKALENIEQQSPDIAQGVHGHLTKRPEQIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVT NDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIRAGLVR | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,564.533 | ||
| Theoretical pI: | 7.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 26.221 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.229 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343569.1 | internal | 227 | 683-3(-) |
Amino Acid sequence : | |||
| AYETCTDAPACQSTRHDAFGRLPHDVGPTPVHLRRVLPGESTTAVSSPATVSVDDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGSNFVVSDSLVVLCGDQHG VDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDLFRSFGEVAVNTLSNIRALLLNILQSLAIISIKSY | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,564.533 | ||
| Theoretical pI: | 7.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 26.221 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.229 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343569.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| VRLDADNCKALENIEQQSPDIAQGVHGHLTKRPEQIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVT NDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIRAGLVR | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,564.533 | ||
| Theoretical pI: | 7.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 26.221 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.229 | ||
| sheet | 0.225 | ||