| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343572.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| KMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSF FRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTM | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,125.870 | ||
| Theoretical pI: | 6.483 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 39.106 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.282 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343572.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| KMSPENPPQPPPNFWGDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSF FRSVRVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTM | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,125.870 | ||
| Theoretical pI: | 6.483 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 39.106 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.282 | ||
| sheet | 0.261 | ||