Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343573.1 | 5prime_partial | 201 | 746-141(-) |
Amino Acid sequence : | |||
EYKDLPAFFMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPFKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNF DKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 15,779.147 | ||
Theoretical pI: | 8.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.615 | ||
aromaticity | 0.043 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343573.1 | complete | 141 | 144-569(+) |
Amino Acid sequence : | |||
MCTTVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,779.147 | ||
Theoretical pI: | 8.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.615 | ||
aromaticity | 0.043 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343573.1 | 5prime_partial | 201 | 746-141(-) |
Amino Acid sequence : | |||
EYKDLPAFFMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPFKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNF DKVKVPFLVLHGTLDGLAEVSGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 15,779.147 | ||
Theoretical pI: | 8.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.615 | ||
aromaticity | 0.043 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343573.1 | complete | 141 | 144-569(+) |
Amino Acid sequence : | |||
MCTTVGTISLNSSINPSPHISQHKISILIGLTLHQRVIHPFIQFQSLVLAAGLLVQHLRPRHFSQPIQGPVQNQEGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,779.147 | ||
Theoretical pI: | 8.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 55.615 | ||
aromaticity | 0.043 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.270 | ||
sheet | 0.191 |