| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343574.1 | 5prime_partial | 194 | 727-143(-) |
Amino Acid sequence : | |||
| FFMGESMGGLLTKLMYFQSAEEGLWTGLIFSAPLFVFPEPMVPCKVHIFMYGLLFGLADTWAAMPDKKMVGMAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKVPF LVLHGTLDGLAEVLGLEMLYQKASSEDKTLKLYEGMYHFLVQGEPDENANLVLADMRAWIDTRVERDGSNSSAH* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 15,694.079 | ||
| Theoretical pI: | 8.863 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 54.526 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343574.1 | complete | 141 | 146-571(+) |
Amino Acid sequence : | |||
| MCTTVGTISLNSSINPSPHISQHKISILIGLTLHQKVIHPFIQFQSLVLAAGLLVQHLQPQHFSQPIQGPVQNQKGHLDLVEIPLHVIRLPYQLSHCPNSGLPGVPHRVARDYLQLLRIF DGHPHHLLVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,694.079 | ||
| Theoretical pI: | 8.863 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 54.526 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.270 | ||
| sheet | 0.184 | ||