Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343599.1 | 5prime_partial | 194 | 3-587(+) |
Amino Acid sequence : | |||
NNLNSKLAFLGDMGSGKSSLVIRFVKGQFLEFPQSTIGAAFFSQTVSVNNATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITSSDSFARAKKWVQELQKQGNPNMVMALAGNKCD LEDKRSVTAEEARAYADENGLFFLETSAKTAVNVNEIFYEIAKKIPKAQPTQNQAGMVLVDRPAEGSRTASCCG* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,210.767 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 35.734 | ||
aromaticity | 0.098 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.237 | ||
sheet | 0.278 |