| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343617.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| HYILGEDIAYFALFPFPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFKHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDSLYESSLVRKEDAPDV VHLTHLTTPESIFHLRLGFAHFASQPHTSKWYLWLMWPLTGWSMMITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQREWITNLIEDAILEADAKGVKVL | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 12,074.646 | ||
| Theoretical pI: | 9.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 58.989 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343617.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
| SLYFGRRHSILRPLPFPVTDNDMDSNGFDDLVRRLYNLHRFHEQHGPLQLQAHSKTTFLHLPSLKISHLHTFISLAAPHSVQDQLFPFHAILRLRVWNNGQVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,074.646 | ||
| Theoretical pI: | 9.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 58.989 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343617.1 | internal | 226 | 3-680(+) |
Amino Acid sequence : | |||
| HYILGEDIAYFALFPFPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFKHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDSLYESSLVRKEDAPDV VHLTHLTTPESIFHLRLGFAHFASQPHTSKWYLWLMWPLTGWSMMITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQREWITNLIEDAILEADAKGVKVL | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 12,074.646 | ||
| Theoretical pI: | 9.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 58.989 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343617.1 | 5prime_partial | 103 | 2-313(+) |
Amino Acid sequence : | |||
| SLYFGRRHSILRPLPFPVTDNDMDSNGFDDLVRRLYNLHRFHEQHGPLQLQAHSKTTFLHLPSLKISHLHTFISLAAPHSVQDQLFPFHAILRLRVWNNGQVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,074.646 | ||
| Theoretical pI: | 9.969 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 58.989 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.233 | ||
| sheet | 0.214 | ||