Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343621.1 | 5prime_partial | 224 | 3-677(+) |
Amino Acid sequence : | |||
ALRNWIDDATGFPGEAYGVRMRKLRRRTLLRDYWVSHMKAEFQNLGHANEPQSFTAAESTLYGNIMSDFASHAFGVLAEDGFSPATVYSSVNASYTVDYRAPVGNKTVEFSPAEVARVFK YLYQSSANPIFENMTWRQCGEAFAGDIVRYFKELQPDAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNHLLRSMQLKGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 11,395.167 | ||
Theoretical pI: | 8.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 28.357 | ||
aromaticity | 0.121 | ||
GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.283 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343621.1 | complete | 99 | 566-267(-) |
Amino Acid sequence : | |||
MPYIKAISNVQSNPWCIPGQNWIGLNQPTLCIWLEFFEIPNNVTGKGFTTLPPCHILENRVCRTLVQVLEHSCNFSWAKFHRLVSYRGSVINSIACIYR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,395.167 | ||
Theoretical pI: | 8.880 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26845 | ||
Instability index: | 28.357 | ||
aromaticity | 0.121 | ||
GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.283 | ||
sheet | 0.162 |