| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343631.1 | complete | 149 | 3-452(+) |
Amino Acid sequence : | |||
| MRKKNREPLLKYIKVKKSSLWRIGKKNKETALQGFCELYKKDIFVKKDHDEYRLERSSENVFLITSLFSFRAAVTSPDSGVQASDNSLIFAGISNFSNLAAFASLSNEVVTSLRVSGFWH KSAKSEYSIPCFEAQASKVCCAATTKATQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 15,341.435 | ||
| Theoretical pI: | 7.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.055 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.187 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343631.1 | 5prime_partial | 139 | 565-146(-) |
Amino Acid sequence : | |||
| ARGKLQHGEYVSLGKVESALVVSPYVDNIMVHANSFHSYCVALVVAAQHTLEAWASKQGIEYSDFADLCQKPETLKEVTTSLLKEAKAARLEKFEIPAKIKLLSEAWTPESGLVTAALKL KREVIRKTFSDDLSSLYSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,341.435 | ||
| Theoretical pI: | 7.118 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 21.055 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.187 | ||
| sheet | 0.331 | ||