| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343646.1 | 3prime_partial | 213 | 39-677(+) |
Amino Acid sequence : | |||
| MARQATKLIGSLSSRLLCPKQLHHHRNFGSPPPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAKAILEAM EAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGI | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 22,602.162 | ||
| Theoretical pI: | 9.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 39.321 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.268 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343646.1 | 3prime_partial | 213 | 39-677(+) |
Amino Acid sequence : | |||
| MARQATKLIGSLSSRLLCPKQLHHHRNFGSPPPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAKAILEAM EAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGI | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 22,602.162 | ||
| Theoretical pI: | 9.465 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 39.321 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.268 | ||
| sheet | 0.225 | ||