| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343649.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| FEFLRDTSFNLLLCCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEHATDALIDLIKEHGRWVEPP VEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,562.488 | ||
| Theoretical pI: | 5.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 35.072 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.211 | ||
| sheet | 0.276 | ||