Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	5prime_partial	223	2-673(+)
Amino Acid sequence :
AKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSV LDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		223
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	complete	184	715-161(-)
Amino Acid sequence :
MFIACKKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDG DVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	5prime_partial	129	3-392(+)
Amino Acid sequence :
LNSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPS WTATICRWR*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	5prime_partial	223	2-673(+)
Amino Acid sequence :
AKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSV LDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		223
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	complete	184	715-161(-)
Amino Acid sequence :
MFIACKKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDG DVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343675.1	5prime_partial	129	3-392(+)
Amino Acid sequence :
LNSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTTTSPS WTATICRWR*
Physicochemical properties
Number of amino acids:		129
Molecular weight:		12,739.899
Theoretical pI:		12.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12490
Instability index:		90.029
aromaticity		0.023
GRAVY		-0.657
Secondary Structure Fraction
Helix		0.078
turn		0.465
sheet		0.217