Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343676.1	5prime_partial	185	787-230(-)
Amino Acid sequence :
PHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYDVSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKV DGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPTSTFTCPESTSYRVVFCP*
Physicochemical properties
Number of amino acids:		185
Molecular weight:		19,548.408
Theoretical pI:		10.800
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		52.114
aromaticity		0.043
GRAVY		0.098
Secondary Structure Fraction
Helix		0.299
turn		0.185
sheet		0.342

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343676.1	complete	184	188-742(+)
Amino Acid sequence :
MFIACKKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDG DVVVVLPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		19,548.408
Theoretical pI:		10.800
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		52.114
aromaticity		0.043
GRAVY		0.098
Secondary Structure Fraction
Helix		0.299
turn		0.185
sheet		0.342