| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343678.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| RTSTKSSEREINSVNDNPLIDFSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIPMAAYCSQLQFLGNPVTNHVQSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,541.816 | ||
| Theoretical pI: | 6.078 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 26.492 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.362 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343678.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| RTSTKSSEREINSVNDNPLIDFSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIPMAAYCSQLQFLGNPVTNHVQSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,541.816 | ||
| Theoretical pI: | 6.078 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 26.492 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.362 | ||
| sheet | 0.216 | ||