| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 3prime_partial | 215 | 121-765(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAI | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
| ISSTSCTSMGARPTLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 5prime_partial | 102 | 765-457(-) |
Amino Acid sequence : | |||
| NRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 3prime_partial | 215 | 121-765(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAI | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 5prime_partial | 126 | 3-383(+) |
Amino Acid sequence : | |||
| ISSTSCTSMGARPTLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343679.1 | 5prime_partial | 102 | 765-457(-) |
Amino Acid sequence : | |||
| NRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 12,230.738 | ||
| Theoretical pI: | 11.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 100.572 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.137 | ||