Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343686.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
IVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYL | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,900.764 | ||
Theoretical pI: | 9.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 42.614 | ||
aromaticity | 0.095 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.247 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343686.1 | internal | 231 | 3-695(+) |
Amino Acid sequence : | |||
IVYTLIAFSSLLYFYLIWSESAKPKTTTHKAPPEASGAWPVIGHLRIMSGHPSAGIPHVNLGMLADKHGPIFSIRLGVHRVVVVSSPEVIKELFTTNDVAVSSRPSVKAGKHLAYDNAML GFASYGAYWRQLRKIVSLELLSNRRLELQSHVSMSETGQFVKELYKLWEKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYL | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,900.764 | ||
Theoretical pI: | 9.707 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39420 | ||
Instability index: | 42.614 | ||
aromaticity | 0.095 | ||
GRAVY | -0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.247 | ||
sheet | 0.260 |