| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343703.1 | 5prime_partial | 136 | 444-34(-) |
Amino Acid sequence : | |||
| HEGQAPMEFKILPIVAFLSVAVVVSHAALPSQEYWNSLLPNTPMPKALKDLLTPTSEWREDKRTSVDVGKGGVNVNTGKPGRTTVNVGGGSGVNVNARNNTHVNVGGGGVTVGTRNRKGK PVYVGVTPTGIPFSYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 11,741.922 | ||
| Theoretical pI: | 4.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 20.497 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343703.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| GGIVELSLGGALKVAEGNAGGGNADVDRFALSVACSDGDAAAADVDVGVVSGVDVDAAPSADVDGGSAGLAGVDVHSALAHVNRGPLVFPPFRSWGQEIFESFRHGSVWKKRIPIFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,741.922 | ||
| Theoretical pI: | 4.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 20.497 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343703.1 | 5prime_partial | 136 | 444-34(-) |
Amino Acid sequence : | |||
| HEGQAPMEFKILPIVAFLSVAVVVSHAALPSQEYWNSLLPNTPMPKALKDLLTPTSEWREDKRTSVDVGKGGVNVNTGKPGRTTVNVGGGSGVNVNARNNTHVNVGGGGVTVGTRNRKGK PVYVGVTPTGIPFSYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 11,741.922 | ||
| Theoretical pI: | 4.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 20.497 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343703.1 | 5prime_partial | 117 | 1-354(+) |
Amino Acid sequence : | |||
| GGIVELSLGGALKVAEGNAGGGNADVDRFALSVACSDGDAAAADVDVGVVSGVDVDAAPSADVDGGSAGLAGVDVHSALAHVNRGPLVFPPFRSWGQEIFESFRHGSVWKKRIPIFL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,741.922 | ||
| Theoretical pI: | 4.605 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 20.497 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.308 | ||
| sheet | 0.248 | ||