| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343704.1 | internal | 215 | 3-647(+) |
Amino Acid sequence : | |||
| WLRPAVKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSG AYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,420.411 | ||
| Theoretical pI: | 8.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 11.970 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.233 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343704.1 | internal | 215 | 3-647(+) |
Amino Acid sequence : | |||
| WLRPAVKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSG AYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGNFRYQKTAAYGHFGRDDPD | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 23,420.411 | ||
| Theoretical pI: | 8.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 11.970 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.233 | ||
| sheet | 0.177 | ||