| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343719.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
| APRLIVYYLRNQATSRPCPVSIIPQVDIYKFDPWQLPGQSNYIYYLYDHLALMIRFVLLHVQTKLSSEKMNGISSPHGIGSTQTGSALIEQLCPATGRRQAPTKPSTVPPNMWVSRKPLF STRAALQRALRQTGSCTSTDSVILSHNPTNKMAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 11,900.005 | ||
| Theoretical pI: | 7.808 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 41.106 | ||
| aromaticity | 0.108 | ||
| GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.304 | ||
| sheet | 0.157 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343719.1 | 3prime_partial | 102 | 405-710(+) |
Amino Acid sequence : | |||
| MHEYRLSDSKSQPYKQNGSMRLDDWVLCRIYKKKNVGRSNVDQPKIEDSFGQIAAANVNHNQNYGSDQCKFPRTHSLTHLWEYDYMNSISHLLNDNSSYNVG | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,900.005 | ||
| Theoretical pI: | 7.808 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 41.106 | ||
| aromaticity | 0.108 | ||
| GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.304 | ||
| sheet | 0.157 | ||