Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343719.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
APRLIVYYLRNQATSRPCPVSIIPQVDIYKFDPWQLPGQSNYIYYLYDHLALMIRFVLLHVQTKLSSEKMNGISSPHGIGSTQTGSALIEQLCPATGRRQAPTKPSTVPPNMWVSRKPLF STRAALQRALRQTGSCTSTDSVILSHNPTNKMAP* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 11,900.005 | ||
Theoretical pI: | 7.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 41.106 | ||
aromaticity | 0.108 | ||
GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.304 | ||
sheet | 0.157 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343719.1 | 3prime_partial | 102 | 405-710(+) |
Amino Acid sequence : | |||
MHEYRLSDSKSQPYKQNGSMRLDDWVLCRIYKKKNVGRSNVDQPKIEDSFGQIAAANVNHNQNYGSDQCKFPRTHSLTHLWEYDYMNSISHLLNDNSSYNVG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,900.005 | ||
Theoretical pI: | 7.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 41.106 | ||
aromaticity | 0.108 | ||
GRAVY | -1.031 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.304 | ||
sheet | 0.157 |