| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRRVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTPKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | 5prime_partial | 164 | 646-152(-) |
Amino Acid sequence : | |||
| PPKTLWGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNPPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQ IEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRRVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTPKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | 5prime_partial | 164 | 646-152(-) |
Amino Acid sequence : | |||
| PPKTLWGRSCYQIAILKWISRFLSSNEATNMRHIAEQKRPALISNPPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQ IEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343722.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,638.533 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 93.328 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
| Helix | 0.153 | ||
| turn | 0.420 | ||
| sheet | 0.173 | ||