Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343728.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
SDDHKPLLHFLAVFLLALVISTHAKIHNYTFVVADTPYSRLCSNKSILTVNGRFPGPTVRVSEGDTISIVVVNRANENITIHWHGVKQLRYPWSDGPEYITQCPIQPGTNFSQRIVLSDE IGTLWWHAHSDWSRATVHGALIVYPQVRNDYPFGAPDGEIPIVLAEWWRSDVQAVVTEFLQNGGGPNNSDAYTINGQPGDLYPCSSQDTFKLSVDNGKTYLIRMVNAVMNNIMFFGIANH KVTIVGTDGAYVKPFTSDYI | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 28,991.404 | ||
Theoretical pI: | 6.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54890 55015 | ||
Instability index: | 25.177 | ||
aromaticity | 0.112 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.269 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343728.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
SDDHKPLLHFLAVFLLALVISTHAKIHNYTFVVADTPYSRLCSNKSILTVNGRFPGPTVRVSEGDTISIVVVNRANENITIHWHGVKQLRYPWSDGPEYITQCPIQPGTNFSQRIVLSDE IGTLWWHAHSDWSRATVHGALIVYPQVRNDYPFGAPDGEIPIVLAEWWRSDVQAVVTEFLQNGGGPNNSDAYTINGQPGDLYPCSSQDTFKLSVDNGKTYLIRMVNAVMNNIMFFGIANH KVTIVGTDGAYVKPFTSDYI | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 28,991.404 | ||
Theoretical pI: | 6.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 54890 55015 | ||
Instability index: | 25.177 | ||
aromaticity | 0.112 | ||
GRAVY | -0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.269 | ||
sheet | 0.162 |