Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | internal | 266 | 799-2(-) |
Amino Acid sequence : | |||
PQLDLHLIQYSRPTGMRYPEHRIPVRNSQRPKRLLQALFYVLGDEPRHIFQEMESEPHFPQVAVDRPVAVGEDRLRRRHHLEQRALHPNDGVGADDERSGAVAEKGLADEAVEMTLAGAA EGDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRRRHVRRHVRIL LQKLFRQVHVPFPYHRFLAHALELFL | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | 3prime_partial | 260 | 20-799(+) |
Amino Acid sequence : | |||
MCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLA ENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAALIVGSDPIVGVERPLFQMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSV FWIAHPGGPAILDQVEVKLG | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | 5prime_partial | 132 | 1-399(+) |
Amino Acid sequence : | |||
LRIIQAHVREIDDKETVHAPDGRVSEGESEHDGVHGAVAGRAAGHRGGGGAEAGERGGAEGHQGMGAAQIQNHPPRFLHHQRRRHARRRLPAHQTPRPPPLRQALHDVPAGLLRRRHRPP HGQGPRREQRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | internal | 266 | 799-2(-) |
Amino Acid sequence : | |||
PQLDLHLIQYSRPTGMRYPEHRIPVRNSQRPKRLLQALFYVLGDEPRHIFQEMESEPHFPQVAVDRPVAVGEDRLRRRHHLEQRALHPNDGVGADDERSGAVAEKGLADEAVEMTLAGAA EGDGGDLRADNQNPSAGVVLGEVLGHAEDGAAGEAALLVHHEALDGGAEAEEFGELVVGAGHVDAAGGAENEVGDFGFGLPPFLDGLLRRLFPQLRHLHHHDVLPRVQRRRHVRRHVRIL LQKLFRQVHVPFPYHRFLAHALELFL | |||
Physicochemical properties | |||
Number of amino acids: | 266 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | 3prime_partial | 260 | 20-799(+) |
Amino Acid sequence : | |||
MCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLA ENNAGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAALIVGSDPIVGVERPLFQMVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSV FWIAHPGGPAILDQVEVKLG | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343740.1 | 5prime_partial | 132 | 1-399(+) |
Amino Acid sequence : | |||
LRIIQAHVREIDDKETVHAPDGRVSEGESEHDGVHGAVAGRAAGHRGGGGAEAGERGGAEGHQGMGAAQIQNHPPRFLHHQRRRHARRRLPAHQTPRPPPLRQALHDVPAGLLRRRHRPP HGQGPRREQRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,629.100 | ||
Theoretical pI: | 11.779 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 73.242 | ||
aromaticity | 0.008 | ||
GRAVY | -1.280 | ||
Secondary Structure Fraction | |||
Helix | 0.136 | ||
turn | 0.258 | ||
sheet | 0.242 |