| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343742.1 | 5prime_partial | 167 | 668-165(-) |
Amino Acid sequence : | |||
| RESTCLPEEIWDMQELRHLRITGSNLPDPSNDAQLPNLLTVHVKAQSCTEKVFKSIPKPKKLGINIVVQPRFDEILNCFEYIFVLQELESLKCVVMNPRLRSQVVAPPVSYPWRLKKLSL SGLGYSWAPMSVIGSLPNLEVLKLRCSAFQGPKWETKAQEFTELEYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,112.104 | ||
| Theoretical pI: | 8.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 50.064 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.246 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343742.1 | 5prime_partial | 167 | 668-165(-) |
Amino Acid sequence : | |||
| RESTCLPEEIWDMQELRHLRITGSNLPDPSNDAQLPNLLTVHVKAQSCTEKVFKSIPKPKKLGINIVVQPRFDEILNCFEYIFVLQELESLKCVVMNPRLRSQVVAPPVSYPWRLKKLSL SGLGYSWAPMSVIGSLPNLEVLKLRCSAFQGPKWETKAQEFTELEYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,112.104 | ||
| Theoretical pI: | 8.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 50.064 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.246 | ||
| sheet | 0.275 | ||