| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343745.1 | internal | 219 | 3-659(+) |
Amino Acid sequence : | |||
| HFLTLAGVPSFFELPPKEGLALVNGTAVGSGLASIVLFEANILAILANVTSALFAEVMQGKPEFTDHLTHKLKHHPGQIESAAIMEHILDGSSYIKEAQKIHEMDPLQKPKQDRYALRTS PQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGF | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 13,187.446 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 49.222 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.274 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343745.1 | complete | 117 | 562-209(-) |
Amino Acid sequence : | |||
| MSFPIDAMARRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSISCIFCASLMYELPSRMCSIMAADSIWPGWCFSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,187.446 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 49.222 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.274 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343745.1 | internal | 219 | 3-659(+) |
Amino Acid sequence : | |||
| HFLTLAGVPSFFELPPKEGLALVNGTAVGSGLASIVLFEANILAILANVTSALFAEVMQGKPEFTDHLTHKLKHHPGQIESAAIMEHILDGSSYIKEAQKIHEMDPLQKPKQDRYALRTS PQWLGPLVEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGF | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 13,187.446 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 49.222 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.274 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343745.1 | complete | 117 | 562-209(-) |
Amino Acid sequence : | |||
| MSFPIDAMARRVLSMETPIGVPWKLPPWRALFRETSISGLSLTELISLSMDLVEVRMTSTRGPSHWGDVRRAYRSCLGFCRGSISCIFCASLMYELPSRMCSIMAADSIWPGWCFSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,187.446 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30855 | ||
| Instability index: | 49.222 | ||
| aromaticity | 0.103 | ||
| GRAVY | 0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.274 | ||
| sheet | 0.274 | ||