| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343747.1 | complete | 149 | 129-578(+) |
Amino Acid sequence : | |||
| MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDD EVDEMIKEADVDGDGQINYEEFVKVMMAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,819.486 | ||
| Theoretical pI: | 4.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 23.058 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.615 | ||
Secondary Structure Fraction | |||
| Helix | 0.242 | ||
| turn | 0.161 | ||
| sheet | 0.329 | ||