| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343761.1 | complete | 122 | 622-254(-) |
Amino Acid sequence : | |||
| MTQSLSTWFHLTSAFIFRANCIAESKNSATLTKCTSVNPLDVRAGVPIRMPPGTMADTSPGTVFLLAAICTASKSFSTLDPSIPFFLKFTKTRWLSVPFDTRSSPFYNKASANLEQFLST CS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 11,198.490 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 36.895 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343761.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| ARGEYADVPTTTTHESLRGPRGAMIFFRKGVKEINKQGQEVKYDYEDKINQTGFPGLQGGPHNHTISGLAVALKQAMTPEYRAYQEQVLRNCSRFAEALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,198.490 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 36.895 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343761.1 | complete | 122 | 622-254(-) |
Amino Acid sequence : | |||
| MTQSLSTWFHLTSAFIFRANCIAESKNSATLTKCTSVNPLDVRAGVPIRMPPGTMADTSPGTVFLLAAICTASKSFSTLDPSIPFFLKFTKTRWLSVPFDTRSSPFYNKASANLEQFLST CS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 11,198.490 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 36.895 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343761.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| ARGEYADVPTTTTHESLRGPRGAMIFFRKGVKEINKQGQEVKYDYEDKINQTGFPGLQGGPHNHTISGLAVALKQAMTPEYRAYQEQVLRNCSRFAEALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,198.490 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 36.895 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.680 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.220 | ||
| sheet | 0.260 | ||