| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| APCREPFSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWCTE RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVAKSKFDNLY GCRH | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | 5prime_partial | 172 | 732-214(-) |
Amino Acid sequence : | |||
| VPASVQVVELALSDRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAP IKRALGAPPVFLESLPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | 5prime_partial | 122 | 3-371(+) |
Amino Acid sequence : | |||
| SLSRTLLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRRLRLEGGDSPGILVVHRA RA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| APCREPFSGREYKVKDMSQADFGRLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWCTE RALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVAKSKFDNLY GCRH | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | 5prime_partial | 172 | 732-214(-) |
Amino Acid sequence : | |||
| VPASVQVVELALSDRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILGRILLQSISDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRRIAAVVDDQIRSAAGAP IKRALGAPPVFLESLPLPGEDGGAVARDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343765.1 | 5prime_partial | 122 | 3-371(+) |
Amino Acid sequence : | |||
| SLSRTLLRPRIQGQGHVSGRLRPPRNRPGRGRDARPHVVPHRIRPLPAIQGRQDHWKPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRARQRRRLRLEGGDSPGILVVHRA RA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 14,301.337 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 83.435 | ||
| aromaticity | 0.008 | ||
| GRAVY | -1.354 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.279 | ||
| sheet | 0.172 | ||