Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343767.1	5prime_partial	128	1-387(+)
Amino Acid sequence :
RHDPFCTSDCEGNLKVTLSVMSTCDERKEVLEDLRSCLVNSHVQVYEKRYMEDVKLKEAEMIKDTKVEETSSSLKSEKTDDKLKPNSSNLKSAAVDKDLDAFLLGDLEDSDDGRYDRNDD SDGGFEKL*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		14,503.853
Theoretical pI:		4.572
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4720
Instability index:		38.605
aromaticity		0.047
GRAVY		-0.927
Secondary Structure Fraction
Helix		0.234
turn		0.203
sheet		0.266