Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343771.1 | 3prime_partial | 231 | 59-751(+) |
Amino Acid sequence : | |||
MVVCTIEESGEHIVAGAGELHLEICLKDLQEDFMGGAEIIKSDPVVSFRETVLERSCRTVMSKSPNKHNRLYMEARPMEEGLAEAIDEGKIGPRDDPKVRSKILSEQFGWDKELAKKIWC FGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGPLAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYSV | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 19,689.435 | ||
Theoretical pI: | 9.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 56.511 | ||
aromaticity | 0.065 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.353 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343771.1 | complete | 184 | 564-10(-) |
Amino Acid sequence : | |||
MPRMFSSANGPSLDAHWKPATTESLISFKYCTPLHISTTMLGPVVSGPKHQIFFASSLSHPNCSDKIFDLTLGSSLGPILPSSMASASPSSIGLASMYSRLCLFGDLLMTVRQDLSRTVS RKETTGSDLIISAPPIKSSCKSFRQISRCNSPAPATICSPDSSIVQTTIGSEVAKRFKPSTSWN* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,689.435 | ||
Theoretical pI: | 9.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 56.511 | ||
aromaticity | 0.065 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.353 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343771.1 | 3prime_partial | 231 | 59-751(+) |
Amino Acid sequence : | |||
MVVCTIEESGEHIVAGAGELHLEICLKDLQEDFMGGAEIIKSDPVVSFRETVLERSCRTVMSKSPNKHNRLYMEARPMEEGLAEAIDEGKIGPRDDPKVRSKILSEQFGWDKELAKKIWC FGPETTGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGPLAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYSV | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 19,689.435 | ||
Theoretical pI: | 9.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 56.511 | ||
aromaticity | 0.065 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.353 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343771.1 | complete | 184 | 564-10(-) |
Amino Acid sequence : | |||
MPRMFSSANGPSLDAHWKPATTESLISFKYCTPLHISTTMLGPVVSGPKHQIFFASSLSHPNCSDKIFDLTLGSSLGPILPSSMASASPSSIGLASMYSRLCLFGDLLMTVRQDLSRTVS RKETTGSDLIISAPPIKSSCKSFRQISRCNSPAPATICSPDSSIVQTTIGSEVAKRFKPSTSWN* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,689.435 | ||
Theoretical pI: | 9.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 56.511 | ||
aromaticity | 0.065 | ||
GRAVY | -0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.255 | ||
turn | 0.353 | ||
sheet | 0.196 |