| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343772.1 | internal | 241 | 3-725(+) |
Amino Acid sequence : | |||
| DGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESAKRDREGG HELEIRVGKIDVNGFSAKQVSADYYFVPPYLYYGRITPNTATKAIDVTLPVVPEEKTAMIIFYCIPVRPGYSRLIFAGARNFAVQVDRFVPRWITHMSHNLIFDSDLFLLHVEERKLKDL D | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,480.258 | ||
| Theoretical pI: | 6.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 42.200 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.220 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343772.1 | internal | 241 | 3-725(+) |
Amino Acid sequence : | |||
| DGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESAKRDREGG HELEIRVGKIDVNGFSAKQVSADYYFVPPYLYYGRITPNTATKAIDVTLPVVPEEKTAMIIFYCIPVRPGYSRLIFAGARNFAVQVDRFVPRWITHMSHNLIFDSDLFLLHVEERKLKDL D | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,480.258 | ||
| Theoretical pI: | 6.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
| Instability index: | 42.200 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.286 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.220 | ||
| sheet | 0.207 | ||