| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343779.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| RWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILEL EKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSD LFLLHVEEQKLKDLDWHK | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 12,012.687 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.073 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.223 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343779.1 | 5prime_partial | 103 | 775-464(-) |
Amino Acid sequence : | |||
| FMPVQIFELLLLDMKKKEIRIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,012.687 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.073 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.223 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343779.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
| RWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILEL EKVKESSKRDREGGHEMEISVGTIDVNGFSAKHVSADYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSD LFLLHVEEQKLKDLDWHK | |||
Physicochemical properties | |||
| Number of amino acids: | 258 | ||
| Molecular weight: | 12,012.687 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.073 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.223 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343779.1 | 5prime_partial | 103 | 775-464(-) |
Amino Acid sequence : | |||
| FMPVQIFELLLLDMKKKEIRIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,012.687 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 43.073 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.223 | ||
| sheet | 0.204 | ||