| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343786.1 | 5prime_partial | 125 | 1-378(+) |
Amino Acid sequence : | |||
| RLVRDSDVGMMVRLVIVLPNLTMNMVKNNFDEGLGASIKKLTGRKNEELAKMVMGASDNIKLTPGSIIEISRLPGYTIQTKVRGDIISTVQSELICRAYINMYLGEDPFDKEAKEKFGAS ILSLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,823.051 | ||
| Theoretical pI: | 8.749 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 30.963 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.248 | ||
| sheet | 0.272 | ||