| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343790.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HIVRDVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLSEEVKRRFYKNWCKSKKKAFSKYSKKLESDEGKKDIQSQLEKLKKYSSVVRVLAHTQIKKMKGL KQKKAHLMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELN | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 13,723.698 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 29.548 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.288 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343790.1 | 5prime_partial | 125 | 685-308(-) |
Amino Acid sequence : | |||
| VQFSAVMVTILTSSCNSKGNSGWMPSTNTSHLTKTSMGLAGKTCHTPTSNNTFISFTLCHTNNVNHLILLKHGIDGHLLLKEAISKVNLLSNSSTIHLYLHQVCLLLLQPFHLLYLGVSQ HTDNR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,723.698 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 29.548 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.288 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343790.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HIVRDVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLSEEVKRRFYKNWCKSKKKAFSKYSKKLESDEGKKDIQSQLEKLKKYSSVVRVLAHTQIKKMKGL KQKKAHLMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELN | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 13,723.698 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 29.548 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.288 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343790.1 | 5prime_partial | 125 | 685-308(-) |
Amino Acid sequence : | |||
| VQFSAVMVTILTSSCNSKGNSGWMPSTNTSHLTKTSMGLAGKTCHTPTSNNTFISFTLCHTNNVNHLILLKHGIDGHLLLKEAISKVNLLSNSSTIHLYLHQVCLLLLQPFHLLYLGVSQ HTDNR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,723.698 | ||
| Theoretical pI: | 9.077 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 29.548 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.102 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.288 | ||
| sheet | 0.224 | ||