| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343802.1 | 3prime_partial | 246 | 43-780(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLI KTYFAD | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,405.066 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48360 | ||
| Instability index: | 26.879 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.224 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343802.1 | 3prime_partial | 246 | 43-780(+) |
Amino Acid sequence : | |||
| MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLI KTYFAD | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 27,405.066 | ||
| Theoretical pI: | 5.323 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48360 48360 | ||
| Instability index: | 26.879 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.224 | ||
| sheet | 0.293 | ||