| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343803.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
| RFDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGN FRYQKTA | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,019.661 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 16.439 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.223 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343803.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
| RFDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFV IGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILSLIKENFDFRPGMMAINLDLLRGGN FRYQKTA | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,019.661 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 16.439 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.223 | ||
| sheet | 0.198 | ||