| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343835.1 | 5prime_partial | 203 | 3-614(+) |
Amino Acid sequence : | |||
| VAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNAYWI NEDSTYKYYEVILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKMRPSRRATWKRNQTLSLRRYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 12,072.444 | ||
| Theoretical pI: | 5.048 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 40.306 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.213 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343835.1 | 3prime_partial | 108 | 430-753(+) |
Amino Acid sequence : | |||
| MTRESTGFATQSTSTESSVDSHLLERNTEVSEERVTCTTRCALQGGQHGRETKHYLSADTANLEALFMCQSLVPVLLEFLENLEVTFLKLSWLLVSGHQFTNPSYVCI | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,072.444 | ||
| Theoretical pI: | 5.048 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 40.306 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.213 | ||
| sheet | 0.306 | ||