| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343849.1 | 3prime_partial | 99 | 476-772(+) |
Amino Acid sequence : | |||
| MLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKRGAKKQRLLWASTSVKNPAYPDTLYVAPLVGPDTVSTMPDQALQAFIDHGSVARTI | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,796.359 | ||
| Theoretical pI: | 9.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 24.803 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.202 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343849.1 | 3prime_partial | 99 | 476-772(+) |
Amino Acid sequence : | |||
| MLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKRGAKKQRLLWASTSVKNPAYPDTLYVAPLVGPDTVSTMPDQALQAFIDHGSVARTI | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,796.359 | ||
| Theoretical pI: | 9.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 24.803 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.202 | ||
| sheet | 0.313 | ||