| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343853.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| HFVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDET VTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFV DSYGTG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,128.164 | ||
| Theoretical pI: | 5.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 32.654 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.240 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343853.1 | internal | 246 | 739-2(-) |
Amino Acid sequence : | |||
| SSSITVDKHRQRLGNTDGVRDLHDAPACQSTRHDALGRLPHDVGPTPVHLRRVLPGESTTAVSSPATVSVDDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGS NFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIDQNLAIIS IKAYKM | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,128.164 | ||
| Theoretical pI: | 5.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 32.654 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.240 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343853.1 | internal | 246 | 2-739(+) |
Amino Acid sequence : | |||
| HFVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDET VTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFV DSYGTG | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,128.164 | ||
| Theoretical pI: | 5.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 32.654 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.240 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343853.1 | internal | 246 | 739-2(-) |
Amino Acid sequence : | |||
| SSSITVDKHRQRLGNTDGVRDLHDAPACQSTRHDALGRLPHDVGPTPVHLRRVLPGESTTAVSSPATVSVDDDLATCETSIAVWTADDKAARRVEVEDGLLVEVLLGDNGLDHVLLEIGS NFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALLLNIDQNLAIIS IKAYKM | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,128.164 | ||
| Theoretical pI: | 5.368 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 32.654 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.240 | ||
| sheet | 0.244 | ||