| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343868.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TSPLQSQHYILLNLAMVLSKTASQSDVSVHSTFASRYVRDSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIA HLFNAPLGDGETAVGVGTVGSSEAIMLAGLAFKRRWQNKMKQLGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLN DLLVEKNKETGWDTPIHVDAA | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,374.249 | ||
| Theoretical pI: | 4.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35660 | ||
| Instability index: | 41.091 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.215 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343868.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TSPLQSQHYILLNLAMVLSKTASQSDVSVHSTFASRYVRDSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIA HLFNAPLGDGETAVGVGTVGSSEAIMLAGLAFKRRWQNKMKQLGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLRDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLN DLLVEKNKETGWDTPIHVDAA | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,374.249 | ||
| Theoretical pI: | 4.980 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35660 | ||
| Instability index: | 41.091 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.215 | ||
| sheet | 0.287 | ||