| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343883.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| RSFVRNEWPSVDIPLYHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTADEPGSNKVRYGISEGKLDSVAEGTVHNYTFYNYASGYIHQCLIDGLQYDTKYYYEIGDGDSSRSFWFQT PLSIDPDAPQTFAIIGDLGQTYNSLSTLEHSLQTSAETILFVGDLSYADRYQYHDVGVRWDSWGRFAERSAAYRPWIWSAGNHEIEYFPYMGEVTPFRNYVQRYPTPYLASKSSSPLWYS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,647.514 | ||
| Theoretical pI: | 10.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 52.940 | ||
| aromaticity | 0.073 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.473 | ||
| turn | 0.155 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343883.1 | complete | 110 | 285-617(+) |
Amino Acid sequence : | |||
| MVFSMILSTTMRSEMVILPEAFGSKLPYPLILMHLRRLQLLVILVRHTILFRLLSTLCRLVQKLFYLLEIFLMLIDTSIMMLVSAGIHGVVLLNAVRHIGHGFGQLEIMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,647.514 | ||
| Theoretical pI: | 10.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 52.940 | ||
| aromaticity | 0.073 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.473 | ||
| turn | 0.155 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343883.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
| RSFVRNEWPSVDIPLYHEVFAVPKGYNAPQQVHITQGDYDGKAVIVSWVTADEPGSNKVRYGISEGKLDSVAEGTVHNYTFYNYASGYIHQCLIDGLQYDTKYYYEIGDGDSSRSFWFQT PLSIDPDAPQTFAIIGDLGQTYNSLSTLEHSLQTSAETILFVGDLSYADRYQYHDVGVRWDSWGRFAERSAAYRPWIWSAGNHEIEYFPYMGEVTPFRNYVQRYPTPYLASKSSSPLWYS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 12,647.514 | ||
| Theoretical pI: | 10.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 52.940 | ||
| aromaticity | 0.073 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.473 | ||
| turn | 0.155 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343883.1 | complete | 110 | 285-617(+) |
Amino Acid sequence : | |||
| MVFSMILSTTMRSEMVILPEAFGSKLPYPLILMHLRRLQLLVILVRHTILFRLLSTLCRLVQKLFYLLEIFLMLIDTSIMMLVSAGIHGVVLLNAVRHIGHGFGQLEIMR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,647.514 | ||
| Theoretical pI: | 10.392 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 52.940 | ||
| aromaticity | 0.073 | ||
| GRAVY | 1.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.473 | ||
| turn | 0.155 | ||
| sheet | 0.364 | ||