| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343888.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| PLTAALTWFFWLLHRHPEVENEILKEIKLQGSNSDVEGYDEVKNMVYTHAALCEAMRLYPPVPVSTKWAAEDDVLPDGTAIKKGTRISYHPYAMGRVEKVWGADWAEFRPKRWLE | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,314.063 | ||
| Theoretical pI: | 5.817 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
| Instability index: | 32.508 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.183 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343888.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| PLTAALTWFFWLLHRHPEVENEILKEIKLQGSNSDVEGYDEVKNMVYTHAALCEAMRLYPPVPVSTKWAAEDDVLPDGTAIKKGTRISYHPYAMGRVEKVWGADWAEFRPKRWLE | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 13,314.063 | ||
| Theoretical pI: | 5.817 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
| Instability index: | 32.508 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.183 | ||
| sheet | 0.304 | ||