Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY343892.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
IMAISTTAAVPMVAETTPFTNSKFAHFSSLQFPSELRISRFSKLCLKSKPRRPTLTLVASKKQSFTSFEELLENSDKPVLVDFYATWCGPCQFMVPILDQVGASMVDKIQIVKIDTEKYP AIANKYNIEALPTFILFKDGKPCDRFEGAMAADPLIKRIEASLQDKQ* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,701.605 | ||
Theoretical pI: | 8.666 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 44.502 | ||
aromaticity | 0.096 | ||
GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.204 | ||
sheet | 0.257 |