| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343896.1 | 3prime_partial | 226 | 73-750(+) |
Amino Acid sequence : | |||
| MAAENGHSGSNGFCVKQNDPLNWGMAAESLKGSHLDEVKKMVEEFRKPVVKLGGETLTISQVAAIAARDDGVAVELVEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGG ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPL | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 12,496.177 | ||
| Theoretical pI: | 6.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 43.874 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343896.1 | 3prime_partial | 118 | 356-3(-) |
Amino Acid sequence : | |||
| MLSITQSLLALTPALAASTSSTATPSSRAAIAATCDIVRVSPPSFTTGFLNSSTIFFTSSRWLPLSDSAAIPQFNGSFCFTQNPLEPLCPFSAAIAIKLYTHTTQTNLIELCGWVGVY | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,496.177 | ||
| Theoretical pI: | 6.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 43.874 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343896.1 | 3prime_partial | 226 | 73-750(+) |
Amino Acid sequence : | |||
| MAAENGHSGSNGFCVKQNDPLNWGMAAESLKGSHLDEVKKMVEEFRKPVVKLGGETLTISQVAAIAARDDGVAVELVEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGG ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGEPL | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 12,496.177 | ||
| Theoretical pI: | 6.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 43.874 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343896.1 | 3prime_partial | 118 | 356-3(-) |
Amino Acid sequence : | |||
| MLSITQSLLALTPALAASTSSTATPSSRAAIAATCDIVRVSPPSFTTGFLNSSTIFFTSSRWLPLSDSAAIPQFNGSFCFTQNPLEPLCPFSAAIAIKLYTHTTQTNLIELCGWVGVY | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,496.177 | ||
| Theoretical pI: | 6.504 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 43.874 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.288 | ||
| sheet | 0.254 | ||