| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343906.1 | 5prime_partial | 238 | 792-76(-) |
Amino Acid sequence : | |||
| RKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDP TKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGAPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 12,352.158 | ||
| Theoretical pI: | 9.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 46.148 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.209 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343906.1 | 3prime_partial | 110 | 463-792(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLTTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFP | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,352.158 | ||
| Theoretical pI: | 9.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 46.148 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.209 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343906.1 | 5prime_partial | 238 | 792-76(-) |
Amino Acid sequence : | |||
| RKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDP TKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGAPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTWEVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 12,352.158 | ||
| Theoretical pI: | 9.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 46.148 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.209 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343906.1 | 3prime_partial | 110 | 463-792(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLTTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFP | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,352.158 | ||
| Theoretical pI: | 9.482 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 46.148 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.209 | ||
| sheet | 0.227 | ||