| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343909.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| PIQKKVCVTGGTGFPGSWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVR RVVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHLKDSSLVHVDDVVRAHI HLLEYPEAKGRYIVKG | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 20,648.882 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 93.630 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343909.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
| DTEKSVCDWRNRVSRIVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,648.882 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 93.630 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343909.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| PIQKKVCVTGGTGFPGSWMIKRLLEDGYSVNATIRLHPERNRDISYITNLPGAAERLQIFNADLDNPETFVPAIKGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVR RVVYTSSISAAAFGSPTNSDGLVDENSWTDVDLIRSLKTFGGPYIVTKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDESHYQHLKDSSLVHVDDVVRAHI HLLEYPEAKGRYIVKG | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 20,648.882 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 93.630 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343909.1 | 5prime_partial | 175 | 3-530(+) |
Amino Acid sequence : | |||
| DTEKSVCDWRNRVSRIVDDQETLGRWLLCQRHNKTSSRAEQGHQLHHQPPRRGGATADLQRRPRQSGDIRASDKRMQRRLPHGSPSRLRRERIGGSKAEASHRRLTRHPAGLRRFQHCPP RGLHFQHLRRSLRLPHKLRRPRRREFVDRRGSDPQPEDLRRAVHRDENVDGESGD* | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,648.882 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 93.630 | ||
| aromaticity | 0.029 | ||
| GRAVY | -1.526 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.234 | ||
| sheet | 0.189 | ||