| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343919.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| PLSLTESASKELSLLKELKRKEEGEFAFGIEDLPYYVKKAKEKQCDLDFGVVKQYFPVSLVLSGIFKMCQDLFGLRFEKVIDAEVWHQDVQLFSVFDLSSGELVGYFYLDIYSREAKYGH TCVMSLQNGSLINNVRQIPVALLISQLPKEVDKHPGLLRFSEVVNLLHEFGHVVHHICNRAAFARFSGLRLDPDFVEIPSLLLENWCYESSSLRLISGFHQDITKPINDELCKSLKRWRC SFSALKLKQEIL | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,951.176 | ||
| Theoretical pI: | 6.283 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
| Instability index: | 41.381 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.206 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343919.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
| PLSLTESASKELSLLKELKRKEEGEFAFGIEDLPYYVKKAKEKQCDLDFGVVKQYFPVSLVLSGIFKMCQDLFGLRFEKVIDAEVWHQDVQLFSVFDLSSGELVGYFYLDIYSREAKYGH TCVMSLQNGSLINNVRQIPVALLISQLPKEVDKHPGLLRFSEVVNLLHEFGHVVHHICNRAAFARFSGLRLDPDFVEIPSLLLENWCYESSSLRLISGFHQDITKPINDELCKSLKRWRC SFSALKLKQEIL | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 28,951.176 | ||
| Theoretical pI: | 6.283 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
| Instability index: | 41.381 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.206 | ||
| sheet | 0.274 | ||