| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343922.1 | 3prime_partial | 186 | 3-560(+) |
Amino Acid sequence : | |||
| MRLPXVVQSSVLPELFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGSRR GNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYKSDGQDTIVIAGAEYGSGS | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,314.634 | ||
| Theoretical pI: | 6.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 39.028 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.308 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343922.1 | 3prime_partial | 186 | 3-560(+) |
Amino Acid sequence : | |||
| MRLPXVVQSSVLPELFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGSRR GNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYKSDGQDTIVIAGAEYGSGS | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 20,314.634 | ||
| Theoretical pI: | 6.906 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 39.028 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.308 | ||
| sheet | 0.205 | ||