| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343923.1 | 5prime_partial | 170 | 557-45(-) |
Amino Acid sequence : | |||
| HEEEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGS RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 18,963.130 | ||
| Theoretical pI: | 6.578 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 45.541 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.563 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.288 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343923.1 | 5prime_partial | 170 | 557-45(-) |
Amino Acid sequence : | |||
| HEEEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKDAYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGS RRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 18,963.130 | ||
| Theoretical pI: | 6.578 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
| Instability index: | 45.541 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.563 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.288 | ||
| sheet | 0.218 | ||