| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343924.1 | complete | 150 | 591-139(-) |
Amino Acid sequence : | |||
| MKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFAMSCSFTNQVIAQLELWKERKSGKSKKEVYVLPKHLDEKVAALHLGKL GGKLTKLTKDQADYISVPVEGPYKPLHYRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,848.465 | ||
| Theoretical pI: | 9.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.197 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343924.1 | 3prime_partial | 147 | 151-591(+) |
Amino Acid sequence : | |||
| MKRLVRSLHRNTDVISLILGELSELPPQLSQVQCSHLLVQVLRQHINLLLGFPTLPLLPQLQLRYHLVRERARHRKARVPCRTPQVHQPTFCQYDYSSIRLWEHPSVSLWLDGDPLHAGV GLKTQHVDLVVEVANVANDGVVLHLLH | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,848.465 | ||
| Theoretical pI: | 9.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.197 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343924.1 | complete | 150 | 591-139(-) |
Amino Acid sequence : | |||
| MKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFAMSCSFTNQVIAQLELWKERKSGKSKKEVYVLPKHLDEKVAALHLGKL GGKLTKLTKDQADYISVPVEGPYKPLHYRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,848.465 | ||
| Theoretical pI: | 9.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.197 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343924.1 | 3prime_partial | 147 | 151-591(+) |
Amino Acid sequence : | |||
| MKRLVRSLHRNTDVISLILGELSELPPQLSQVQCSHLLVQVLRQHINLLLGFPTLPLLPQLQLRYHLVRERARHRKARVPCRTPQVHQPTFCQYDYSSIRLWEHPSVSLWLDGDPLHAGV GLKTQHVDLVVEVANVANDGVVLHLLH | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,848.465 | ||
| Theoretical pI: | 9.297 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 44.837 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.197 | ||
| sheet | 0.265 | ||