| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343936.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| PLSMKITQISKKLIPSFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLNALLPYQ YLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAWSG | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,951.648 | ||
| Theoretical pI: | 4.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 34.339 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.202 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343936.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| PLSMKITQISKKLIPSFTPTPENLKNYSISFLDKCMEHMNFAVILFYKSKPENITHLEESLAKILVQFYPLAGRYIKNDHIVDCSDQGVEFIEAEALDVELLDLIAKIETEQLNALLPYQ YLRLDEADPILGIKVTRFSDDGVSIAVSVHHTIFDMSSLGTFIAAWSG | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 18,951.648 | ||
| Theoretical pI: | 4.918 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 34.339 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.202 | ||
| sheet | 0.280 | ||