Acc_NO	ORF type	length	start-end position (strand +/-)
>DY343939.1	5prime_partial	234	2-706(+)
Amino Acid sequence :
PPGRALRMVEEYRKPVVRLGGETLTIAQVAAVARRETAVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKDTDSTHTLPHSATRAS MLVRINTLLQGYSGIRFEILEAIAKFLNLNITPCLPLRGTITASGDLVPLSYIAGVLLGRPNSKAIGPNGEVLDAGXALTLAGVPSFFELQPQRRTSPSKWDSSGVRPNVYSPL*
Physicochemical properties
Number of amino acids:		234
Molecular weight:		24,960.296
Theoretical pI:		9.756
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18450
Instability index:		40.089
aromaticity		0.060
GRAVY		-0.109
Secondary Structure Fraction
Helix		0.288
turn		0.270
sheet		0.279