| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY343939.1 | 5prime_partial | 234 | 2-706(+) |
Amino Acid sequence : | |||
| PPGRALRMVEEYRKPVVRLGGETLTIAQVAAVARRETAVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGKDTDSTHTLPHSATRAS MLVRINTLLQGYSGIRFEILEAIAKFLNLNITPCLPLRGTITASGDLVPLSYIAGVLLGRPNSKAIGPNGEVLDAGXALTLAGVPSFFELQPQRRTSPSKWDSSGVRPNVYSPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 24,960.296 | ||
| Theoretical pI: | 9.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 40.089 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.270 | ||
| sheet | 0.279 | ||